VDAC2 Antibody
| Name | VDAC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80065 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2 Synthetic peptide directed towards the N terminal of human VDAC2. Peptide sequence MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | VDAC2 |
| Supplier Page | Shop |
Product images
![Western Blot: VDAC2 Antibody [NBP1-80065] - WB Suggested Anti-VDAC2 Antibody Titration: 1.6 ug/ml Positive Control: human cell lines](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/607_VDAC2-Antibody-Western-Blot-NBP1-80065-img0002.jpg)
Western Blot: VDAC2 Antibody [NBP1-80065] - WB Suggested Anti-VDAC2 Antibody Titration: 1.6 ug/ml Positive Control: human cell lines
![Western Blot: VDAC2 Antibody [NBP1-80065] - VDAC2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/609_VDAC2-Antibody-Western-Blot-NBP1-80065-img0001.jpg)
Western Blot: VDAC2 Antibody [NBP1-80065] - VDAC2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T
![Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/25174_VDAC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80065-img0004.jpg)
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic