KA2/GRIK5/Glutamate Receptor KA2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-80270
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GRIK5
• Conjugate: Unconjugated

Product images

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunocytochemistry/Immunofluorescence: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Membrane in cell processes

Immunocytochemistry/Immunofluorescence: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Mouse Retina, 25ug/ml.