BRDT Antibody

Name BRDT Antibody
Supplier Novus Biologicals
Catalog NBP1-80294
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human BRDT. Peptide sequence MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW.
Purity/Format Immunogen affinity purified
Blocking Peptide BRDT Peptide
Description Rabbit Polyclonal
Gene BRDT
Conjugate Unconjugated
Supplier Page Shop

Product images