Wnt-10a Antibody
| Name | Wnt-10a Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69116 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to Wnt10a (wingless related MMTV integration site 10a) The peptide sequence was selected from the middle region of Wnt10a. Peptide sequence RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WNT10A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Wnt-10a Antibody [NBP1-69116] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4092_Wnt-10a-Antibody-Western-Blot-NBP1-69116-img0001.jpg)
![Immunohistochemistry-Paraffin: Wnt-10a Antibody [NBP1-69116] - Human testis tissue at an antibody concentration of 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4093_Wnt-10a-Antibody-Immunohistochemistry-Paraffin-NBP1-69116-img0003.jpg)