UBE2N/Ubc13 Antibody

Name UBE2N/Ubc13 Antibody
Supplier Novus Biologicals
Catalog NBP1-54894
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene UBE2N
Conjugate Unconjugated
Supplier Page Shop

Product images