RGS10 Antibody
| Name | RGS10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55396 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB FC IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RGS10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RGS10 Antibody [NBP1-55396] - Bone marrow derived monocytes, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19882_RGS10-Antibody-Western-Blot-NBP1-55396-img0001.jpg)
![Flow Cytometry: RGS10 Antibody [NBP1-55396] - bone marrow derived monocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19883_RGS10-Antibody-Flow-Cytometry-NBP1-55396-img0002.jpg)