TAF11 Antibody (3G6)

• Supplier: Novus Biologicals
• Catalog: H00006882-M06
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 3G6
• Applications: WB ELISA ICC/IF IHC-P
• Species Reactivities: Human
• Antigen: TAF11 (NP_005634 158 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: TAF11
• Conjugate: Unconjugated

Product images

Western Blot: TAF11 Antibody (3G6) [H00006882-M06] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).

Immunocytochemistry/Immunofluorescence: TAF11 Antibody (3G6) [H00006882-M06] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: TAF11 Antibody (3G6) [H00006882-M06] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.2 ug/ml

ELISA: TAF11 Antibody (3G6) [H00006882-M06] - Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.