GCM1 Antibody (2E11.)

Name GCM1 Antibody (2E11.)
Supplier Novus Biologicals
Catalog H00008521-M05
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 2E11.
Applications WB ELISA ICC/IF IHC-P
Species Reactivities Human
Antigen GCM1 (NP_003634, 108 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Purity/Format IgG purified
Description Mouse Monoclonal
Gene GCM1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.