SAPS3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-34049
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SAPS3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PPP6R3
• Conjugate: Unconjugated

Product images

Western Blot: SAPS3 Antibody [NBP2-34049] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: SAPS3 Antibody [NBP2-34049] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34049] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.