Fbl14 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33296
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Fbl14 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FBXL14
• Conjugate: Unconjugated

Product images

Western Blot: Fbl14 Antibody [NBP2-33296] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: Fbl14 Antibody [NBP2-33296] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Immunohistochemistry: Fbl14 Antibody [NBP2-33296] - Staining of human tonsil shows strong cytoplasmic in germinal center cells.