GLB1L2 Antibody
| Name | GLB1L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31804 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DNKDGLSKGIVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GLB1L2 Protein |
| Description | Rabbit Polyclonal |
| Gene | GLB1L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GLB1L2 Antibody [NBP2-31804] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7203_GLB1L2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31804-img0009.jpg)
Immunocytochemistry/Immunofluorescence: GLB1L2 Antibody [NBP2-31804] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & vesicles.
![Immunohistochemistry-Paraffin: GLB1L2 Antibody [NBP2-31804] - Staining of human small intestine shows moderate membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7204_GLB1L2-Antibody-Immunohistochemistry-Paraffin-NBP2-31804-img0008.jpg)
Immunohistochemistry-Paraffin: GLB1L2 Antibody [NBP2-31804] - Staining of human small intestine shows moderate membranous positivity in glandular cells.