HCFC1R1 Antibody
| Name | HCFC1R1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31788 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HCFC1R1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HCFC1R1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HCFC1R1 Antibody [NBP2-31788] - Staining of human cell line A549 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10628_HCFC1R1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31788-img0007.jpg)
Immunocytochemistry/Immunofluorescence: HCFC1R1 Antibody [NBP2-31788] - Staining of human cell line A549 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: HCFC1R1 Antibody [NBP2-31788] - Staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10629_HCFC1R1-Antibody-Immunohistochemistry-Paraffin-NBP2-31788-img0008.jpg)
Immunohistochemistry-Paraffin: HCFC1R1 Antibody [NBP2-31788] - Staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.