IYD Antibody
| Name | IYD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31786 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IYD Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IYD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: IYD Antibody [NBP2-31786] - Staining of human cell line CACO-2 shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9521_IYD-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31786-img0007.jpg)
![Immunohistochemistry-Paraffin: IYD Antibody [NBP2-31786] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9522_IYD-Antibody-Immunohistochemistry-Paraffin-NBP2-31786-img0008.jpg)