MRPS21 Antibody
| Name | MRPS21 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31762 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPC |
| Description | Rabbit Polyclonal |
| Gene | MRPS21 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - pancreas](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5379_MRPS21-Antibody-Immunohistochemistry-NBP2-31762-img0005.jpg)
Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - pancreas
![Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5380_MRPS21-Antibody-Immunohistochemistry-NBP2-31762-img0001.jpg)
Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells of seminiferus ducts.
![Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - pancreas](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5381_MRPS21-Antibody-Immunohistochemistry-NBP2-31762-img0002.jpg)
Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - pancreas
![Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5382_MRPS21-Antibody-Immunohistochemistry-NBP2-31762-img0003.jpg)
Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - liver cancer
![Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5383_MRPS21-Antibody-Immunohistochemistry-NBP2-31762-img0004.jpg)
Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells of seminiferus ducts.
![Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5384_MRPS21%2520Antibody-Immunohistochemistry-NBP2-31762-img0006.jpg)
Immunohistochemistry: MRPS21 Antibody [NBP2-31762] - liver cancer