C9orf100 Antibody
| Name | C9orf100 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31850 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVAL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf100 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ARHGEF39 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C9orf100 Antibody [NBP2-31850] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2344_C9orf100-Antibody-Immunohistochemistry-Paraffin-NBP2-31850-img0007.jpg)
Immunohistochemistry-Paraffin: C9orf100 Antibody [NBP2-31850] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.