C4orf17 Antibody
| Name | C4orf17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31831 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IMARNVSCFLVRHTPHPRRVCHIKGLNNIPICTVNDDENAFGTLWGVGQSNYLEKNRIPFANCSYPSSTAVQESPVRGMSPAPNGAKVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C4orf17 Protein |
| Description | Rabbit Polyclonal |
| Gene | C4orf17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: C4orf17 Antibody [NBP2-31831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Testis tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11703_C4orf17-Antibody-Western-Blot-NBP2-31831-img0008.jpg)
![Immunohistochemistry-Paraffin: C4orf17 Antibody [NBP2-31831] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11704_C4orf17-Antibody-Immunohistochemistry-Paraffin-NBP2-31831-img0007.jpg)