LMBR1L Antibody
| Name | LMBR1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31680 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LMBR1L Protein |
| Description | Rabbit Polyclonal |
| Gene | LMBR1L |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5619_LMBR1L-Antibody-Immunohistochemistry-NBP2-31680-img0005.jpg)
Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver
![Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5620_LMBR1L-Antibody-Immunohistochemistry-NBP2-31680-img0001.jpg)
Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
![Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5621_LMBR1L-Antibody-Immunohistochemistry-NBP2-31680-img0002.jpg)
Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver
![Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5622_LMBR1L-Antibody-Immunohistochemistry-NBP2-31680-img0003.jpg)
Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver cancer
![Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5623_LMBR1L-Antibody-Immunohistochemistry-NBP2-31680-img0004.jpg)
Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
![Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5624_LMBR1L%2520Antibody-Immunohistochemistry-NBP2-31680-img0006.jpg)
Immunohistochemistry: LMBR1L Antibody [NBP2-31680] - liver cancer