SLC35B1 Antibody
| Name | SLC35B1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31677 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC35B1 Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC35B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of breast.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5564_SLC35B1-Antibody-Immunohistochemistry-NBP2-31677-img0005.jpg)
Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of breast.
![Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of human colon shows strong cytoplasmic positivity in glandular cells and endothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5565_SLC35B1-Antibody-Immunohistochemistry-NBP2-31677-img0001.jpg)
Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of human colon shows strong cytoplasmic positivity in glandular cells and endothelial cells.
![Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of breast.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5566_SLC35B1-Antibody-Immunohistochemistry-NBP2-31677-img0002.jpg)
Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of breast.
![Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of melanoma.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5567_SLC35B1-Antibody-Immunohistochemistry-NBP2-31677-img0003.jpg)
Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of melanoma.
![Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of human colon shows strong cytoplasmic positivity in glandular cells and endothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5568_SLC35B1-Antibody-Immunohistochemistry-NBP2-31677-img0004.jpg)
Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of human colon shows strong cytoplasmic positivity in glandular cells and endothelial cells.
![Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of melanoma.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5569_SLC35B1%2520Antibody-Immunohistochemistry-NBP2-31677-img0006.jpg)
Immunohistochemistry: SLC35B1 Antibody [NBP2-31677] - Staining of melanoma.