RBM18 Antibody
| Name | RBM18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31670 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RBM18 Protein |
| Description | Rabbit Polyclonal |
| Gene | RBM18 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5649_RBM18-Antibody-Immunohistochemistry-NBP2-31670-img0005.jpg)
Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver
![Immunohistochemistry: RBM18 Antibody [NBP2-31670] - Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subset of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5650_RBM18-Antibody-Immunohistochemistry-NBP2-31670-img0001.jpg)
Immunohistochemistry: RBM18 Antibody [NBP2-31670] - Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subset of tubules.
![Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5651_RBM18-Antibody-Immunohistochemistry-NBP2-31670-img0002.jpg)
Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver
![Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5652_RBM18-Antibody-Immunohistochemistry-NBP2-31670-img0003.jpg)
Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver cancer
![Immunohistochemistry: RBM18 Antibody [NBP2-31670] - Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subset of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5653_RBM18-Antibody-Immunohistochemistry-NBP2-31670-img0004.jpg)
Immunohistochemistry: RBM18 Antibody [NBP2-31670] - Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subset of tubules.
![Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5654_RBM18%2520Antibody-Immunohistochemistry-NBP2-31670-img0006.jpg)
Immunohistochemistry: RBM18 Antibody [NBP2-31670] - liver cancer