LSMD1 Antibody
| Name | LSMD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31753 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MRIRMTDGRTLVGCFLCTDRDCNVILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLTGPPY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LSMD1 Protein |
| Description | Rabbit Polyclonal |
| Gene | NAA38 |
| Supplier Page | Shop |
![Immunohistochemistry: LSMD1 Antibody [NBP2-31753] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5692_LSMD1-Antibody-Immunohistochemistry-NBP2-31753-img0001.jpg)
![Immunohistochemistry: LSMD1 Antibody [NBP2-31753] - heart muscle](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5693_LSMD1-Antibody-Immunohistochemistry-NBP2-31753-img0002.jpg)
![Immunohistochemistry: LSMD1 Antibody [NBP2-31753] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/5696_LSMD1%2520Antibody-Immunohistochemistry-NBP2-31753-img0006.jpg)