BCL6B Antibody
| Name | BCL6B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31749 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BCL6B Protein |
| Description | Rabbit Polyclonal |
| Gene | BCL6B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: BCL6B Antibody [NBP2-31749] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2343_BCL6B-Antibody-Immunohistochemistry-Paraffin-NBP2-31749-img0007.jpg)
Immunohistochemistry-Paraffin: BCL6B Antibody [NBP2-31749] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.