COA5 Antibody
| Name | COA5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31690 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COA5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: COA5 Antibody [NBP2-31690] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HepG2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17144_COA5-Antibody-Western-Blot-NBP2-31690-img0009.jpg)
Western Blot: COA5 Antibody [NBP2-31690] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HepG2
![Immunocytochemistry/Immunofluorescence: COA5 Antibody [NBP2-31690] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17145_COA5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31690-img0007.jpg)
Immunocytochemistry/Immunofluorescence: COA5 Antibody [NBP2-31690] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: COA5 Antibody [NBP2-31690] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17146_COA5-Antibody-Immunohistochemistry-Paraffin-NBP2-31690-img0008.jpg)
Immunohistochemistry-Paraffin: COA5 Antibody [NBP2-31690] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules