GALNTL1 Antibody

Name GALNTL1 Antibody
Supplier Novus Biologicals
Catalog NBP2-31747
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH
Purity/Format Immunogen affinity purified
Blocking Peptide GALNTL1 Protein
Description Rabbit Polyclonal
Gene GALNT16
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.