ARPP19 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31652
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: ARPP19 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: ARPP19
• Conjugate: Unconjugated

Product images

Immunohistochemistry-Paraffin: ARPP19 Antibody [NBP2-31652] - Staining of human cerebral cortex shows strong Cytoplasmic positivity in neuropil.

Immunohistochemistry: ARPP19 Antibody [NBP2-31652] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry: ARPP19 Antibody [NBP2-31652] - Staining of adrenal gland.

Immunohistochemistry: ARPP19 Antibody [NBP2-31652] - Staining of liver cancer.