BRP44 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31623
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: BRP44 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: MPC2
• Conjugate: Unconjugated

Product images

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: BRP44 Antibody [NBP2-31623] - Staining of human pancreas shows moderate cytoplasmic positivity.