CYP20A1 Antibody
| Name | CYP20A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31614 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CYP20A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CYP20A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CYP20A1 Antibody [NBP2-31614] - Staining of human cell line CACO-2 shows positivity in nucleoli, plasma membrane, actin filaments & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9511_CYP20A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31614-img0007.jpg)
Immunocytochemistry/Immunofluorescence: CYP20A1 Antibody [NBP2-31614] - Staining of human cell line CACO-2 shows positivity in nucleoli, plasma membrane, actin filaments & cell junctions.
![Immunohistochemistry-Paraffin: CYP20A1 Antibody [NBP2-31614] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9512_CYP20A1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-31614-img0008.jpg)
Immunohistochemistry-Paraffin: CYP20A1 Antibody [NBP2-31614] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.