SYT10 Antibody
| Name | SYT10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31604 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SYT10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYT10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SYT10 Antibody [NBP2-31604] - Staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6063_SYT10-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31604-img0007.jpg)
Immunocytochemistry/Immunofluorescence: SYT10 Antibody [NBP2-31604] - Staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
![Immunohistochemistry: SYT10 Antibody [NBP2-31604] - Staining of human pancreas shows strong cytoplasmic positivity in subset of cells in islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6064_SYT10-Antibody-Immunohistochemistry-NBP2-31604-img0004.jpg)
Immunohistochemistry: SYT10 Antibody [NBP2-31604] - Staining of human pancreas shows strong cytoplasmic positivity in subset of cells in islets of Langerhans.