Carbonic Anhydrase X/CA10 Antibody
| Name | Carbonic Anhydrase X/CA10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31586 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Carbonic Anhydrase X/CA10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CA10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6783_CA10-Antibody-Immunohistochemistry-NBP2-31586-img0005.jpg)
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of pancreas.
![Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6784_CA10-Antibody-Immunohistochemistry-NBP2-31586-img0001.jpg)
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
![Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6785_CA10-Antibody-Immunohistochemistry-NBP2-31586-img0002.jpg)
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of pancreas.
![Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6786_CA10-Antibody-Immunohistochemistry-NBP2-31586-img0003.jpg)
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of liver cancer.
![Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6787_CA10-Antibody-Immunohistochemistry-NBP2-31586-img0004.jpg)
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
![Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6788_CA10%2520Antibody-Immunohistochemistry-NBP2-31586-img0006.jpg)
Immunohistochemistry: CA10 Antibody [NBP2-31586] - Staining of liver cancer.