SLC38A10 Antibody
| Name | SLC38A10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81193 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PEDLAGEAPGGRLGEAEGLMKVEAARLSAQDPVVAVAEDGREKPKLPKEREELEQAQIKGPVDVPGREDGKEAPEEAQLDRPGQGIAVPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC38A10 Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC38A10 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC38A10 Antibody [NBP1-81193] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6284_SLC38A10-Antibody-Western-Blot-NBP1-81193-img0003.jpg)
Western Blot: SLC38A10 Antibody [NBP1-81193] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
![Immunocytochemistry/Immunofluorescence: SLC38A10 Antibody [NBP1-81193] - Staining of human cell line U-2 OS shows positivity in golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6285_SLC38A10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81193-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC38A10 Antibody [NBP1-81193] - Staining of human cell line U-2 OS shows positivity in golgi apparatus.
![Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6286_SLC38A10-Antibody-Immunohistochemistry-Paraffin-NBP1-81193-img0002.jpg)
Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.
![Western Blot: SLC38A10 Antibody [NBP1-81193] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6287_SLC38A10%2520Antibody-Western%2520Blot-NBP1-81193-img0005.jpg)
Western Blot: SLC38A10 Antibody [NBP1-81193] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Simple Western: SLC38A10 Antibody [NBP1-81193] - Simple Western lane view shows a specific band for SLC38A10 in 0.2 mg/ml of RT-4 (left) and U-2OS (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/20951_SLC38A10-Antibody-Simple-Western-NBP1-81193-img0006.jpg)
Simple Western: SLC38A10 Antibody [NBP1-81193] - Simple Western lane view shows a specific band for SLC38A10 in 0.2 mg/ml of RT-4 (left) and U-2OS (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.