Semaphorin 6D Antibody
| Name | Semaphorin 6D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82316 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTMASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Semaphorin 6D Protein |
| Description | Rabbit Polyclonal |
| Gene | SEMA6D |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Semaphorin 6D Antibody [NBP1-82316] - Staining of human cell line A-431 shows positivity in plasma membrane & golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6387_Semaphorin-6D-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82316-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Semaphorin 6D Antibody [NBP1-82316] - Staining of human cell line A-431 shows positivity in plasma membrane & golgi apparatus.
![Immunohistochemistry-Paraffin: Semaphorin 6D Antibody [NBP1-82316] - Staining of human stomach, upper shows strong cytoplasmic positivity in gastric parietal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6388_Semaphorin-6D-Antibody-Immunohistochemistry-Paraffin-NBP1-82316-img0005.jpg)
Immunohistochemistry-Paraffin: Semaphorin 6D Antibody [NBP1-82316] - Staining of human stomach, upper shows strong cytoplasmic positivity in gastric parietal cells.