MTHFD1 Antibody
| Name | MTHFD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82611 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGETKAKVLLSALEGAPHR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MTHFD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MTHFD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MTHFD1 Antibody [NBP1-82611] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-432](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29543_MTHFD1-Antibody-Western-Blot-NBP1-82611-img0006.jpg)
Western Blot: MTHFD1 Antibody [NBP1-82611] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-432
![Immunocytochemistry/Immunofluorescence: MTHFD1 Antibody [NBP1-82611] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29544_MTHFD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82611-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MTHFD1 Antibody [NBP1-82611] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: MTHFD1 Antibody [NBP1-82611] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29545_MTHFD1-Antibody-Immunohistochemistry-Paraffin-NBP1-82611-img0007.jpg)
Immunohistochemistry-Paraffin: MTHFD1 Antibody [NBP1-82611] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
![Western Blot: MTHFD1 Antibody [NBP1-82611] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29546_MTHFD1-Antibody-Western-Blot-NBP1-82611-img0003.jpg)
Western Blot: MTHFD1 Antibody [NBP1-82611] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue