ZNF565 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-81951
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:DVTGPWCPDLESRCEKFLQKDIFEIGAFNWEIMESLKCSDLEGSDFRADWECEGQFERQVNEECYFKQVNVTYGHMPVFQHHTSHTV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: ZNF565 Protein
• Description: Rabbit Polyclonal
• Gene: ZNF565

Product images

Western Blot: ZNF565 Antibody [NBP1-81951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Immunocytochemistry/Immunofluorescence: ZNF565 Antibody [NBP1-81951] - Staining of human cell line A-431 shows positivity in nucleus.

Immunohistochemistry-Paraffin: ZNF565 Antibody [NBP1-81951] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Western Blot: ZNF565 Antibody [NBP1-81951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4