FRG2B Antibody
| Name | FRG2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32633 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MGKGNEDPDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSHSSE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FRG2B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FRG2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FRG2B Antibody [NBP2-32633] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20026_FRG2B-Antibody-Immunohistochemistry-NBP2-32633-img0001.jpg)
Immunohistochemistry: FRG2B Antibody [NBP2-32633] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.