TP53I11 Antibody
| Name | TP53I11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32593 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TP53I11 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TP53I11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TP53I11 Antibody [NBP2-32593] - Immunofluorescent staining of human cell line A549 shows localization to endoplasmic reticulum & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6807_TP53I11%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32593-img0007.jpg)
Immunocytochemistry/Immunofluorescence: TP53I11 Antibody [NBP2-32593] - Immunofluorescent staining of human cell line A549 shows localization to endoplasmic reticulum & the Golgi apparatus.
![Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-32593] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6808_TP53I11-Antibody-Immunohistochemistry-Paraffin-NBP2-32593-img0008.jpg)
Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-32593] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.