Shisa-4 Antibody
| Name | Shisa-4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32592 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Shisa-4 Protein |
| Description | Rabbit Polyclonal |
| Gene | SHISA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Shisa-4 Antibody [NBP2-32592] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3136_Shisa-4%2520Antibody-Immunohistochemistry-Paraffin-NBP2-32592-img0010.jpg)
Immunohistochemistry-Paraffin: Shisa-4 Antibody [NBP2-32592] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.