CHD2 Antibody
| Name | CHD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32563 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QHWYKDHHYGDRRHMDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CHD2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CHD2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6683_CHD2-Antibody-Immunohistochemistry-NBP2-32563-img0005.jpg)
Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver
![Immunohistochemistry: CHD2 Antibody [NBP2-32563] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6684_CHD2-Antibody-Immunohistochemistry-NBP2-32563-img0001.jpg)
Immunohistochemistry: CHD2 Antibody [NBP2-32563] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
![Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6685_CHD2-Antibody-Immunohistochemistry-NBP2-32563-img0002.jpg)
Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver
![Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6686_CHD2-Antibody-Immunohistochemistry-NBP2-32563-img0003.jpg)
Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver cancer
![Immunohistochemistry: CHD2 Antibody [NBP2-32563] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6687_CHD2-Antibody-Immunohistochemistry-NBP2-32563-img0004.jpg)
Immunohistochemistry: CHD2 Antibody [NBP2-32563] - Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
![Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6688_CHD2%2520Antibody-Immunohistochemistry-NBP2-32563-img0006.jpg)
Immunohistochemistry: CHD2 Antibody [NBP2-32563] - liver cancer