LCN15 Antibody
| Name | LCN15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32557 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FAVLYIYKELEGALSTMVQLYSRTQDVSPQALKAFQDFYPTLGLPEDMMVMLPQSDACNPESKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LCN15 Protein |
| Description | Rabbit Polyclonal |
| Gene | LCN15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of duodenum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5768_LCN15-Antibody-Immunohistochemistry-NBP2-32557-img0005.jpg)
Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of duodenum.
![Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of human nasopharynx shows moderate nuclear and cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5769_LCN15-Antibody-Immunohistochemistry-NBP2-32557-img0001.jpg)
Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of human nasopharynx shows moderate nuclear and cytoplasmic positivity in respiratory epithelial cells.
![Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of duodenum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5770_LCN15-Antibody-Immunohistochemistry-NBP2-32557-img0002.jpg)
Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of duodenum.
![Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of breast cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5771_LCN15-Antibody-Immunohistochemistry-NBP2-32557-img0003.jpg)
Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of breast cancer.
![Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of human nasopharynx shows moderate nuclear and cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5772_LCN15-Antibody-Immunohistochemistry-NBP2-32557-img0004.jpg)
Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of human nasopharynx shows moderate nuclear and cytoplasmic positivity in respiratory epithelial cells.
![Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of breast cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5773_LCN15%2520Antibody-Immunohistochemistry-NBP2-32557-img0006.jpg)
Immunohistochemistry: LCN15 Antibody [NBP2-32557] - Staining of breast cancer.