NANOGNB Antibody
| Name | NANOGNB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32538 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TILANKKQSAMPWDQDPEQSTGNYSEDEQNGKQKWREEGEAGRKRE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NANOGNB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NANOGNB |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6779_NANOGNB-Antibody-Immunohistochemistry-NBP2-32538-img0005.jpg)
Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver
![Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6780_NANOGNB-Antibody-Immunohistochemistry-NBP2-32538-img0001.jpg)
Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6781_NANOGNB-Antibody-Immunohistochemistry-NBP2-32538-img0002.jpg)
Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver
![Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6782_NANOGNB-Antibody-Immunohistochemistry-NBP2-32538-img0003.jpg)
Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver cancer
![Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6783_NANOGNB-Antibody-Immunohistochemistry-NBP2-32538-img0004.jpg)
Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6784_NANOGNB%2520Antibody-Immunohistochemistry-NBP2-32538-img0006.jpg)
Immunohistochemistry: NANOGNB Antibody [NBP2-32538] - liver cancer