ZNF554 Antibody
| Name | ZNF554 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32519 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF554 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF554 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: ZNF554 Antibody [NBP2-32519] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8185_ZNF554-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32519-img0007.jpg)
![Immunohistochemistry-Paraffin: ZNF554 Antibody [NBP2-32519] - Staining of human esophagus shows moderate nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8186_ZNF554%2520Antibody-Immunohistochemistry-Paraffin-NBP2-32519-img0008.jpg)