EID3 Antibody
| Name | EID3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32455 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EID3 Protein |
| Description | Rabbit Polyclonal |
| Gene | EID3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: EID3 Antibody [NBP2-32455] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9015_EID3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32455-img0007.jpg)
![Immunohistochemistry-Paraffin: EID3 Antibody [NBP2-32455] - Staining of human epididymis shows moderate nuclear positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9016_EID3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-32455-img0008.jpg)