SHISA7 Antibody
| Name | SHISA7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32407 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SHISA7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SHISA7 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - breast](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7078_SHISA7-Antibody-Immunohistochemistry-NBP2-32407-img0005.jpg)
Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - breast
![Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7079_SHISA7-Antibody-Immunohistochemistry-NBP2-32407-img0001.jpg)
Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
![Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - breast](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7080_SHISA7-Antibody-Immunohistochemistry-NBP2-32407-img0002.jpg)
Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - breast
![Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7081_SHISA7-Antibody-Immunohistochemistry-NBP2-32407-img0003.jpg)
Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - liver cancer
![Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7082_SHISA7-Antibody-Immunohistochemistry-NBP2-32407-img0004.jpg)
Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
![Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7083_SHISA7%2520Antibody-Immunohistochemistry-NBP2-32407-img0006.jpg)
Immunohistochemistry: SHISA7 Antibody [NBP2-32407] - liver cancer