TBC1D29 Antibody
| Name | TBC1D29 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32437 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TBC1D29 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TBC1D29 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of oral mucosa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6723_TBC1D29-Antibody-Immunohistochemistry-NBP2-32437-img0005.jpg)
Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of oral mucosa.
![Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6724_TBC1D29-Antibody-Immunohistochemistry-NBP2-32437-img0001.jpg)
Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.
![Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of oral mucosa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6725_TBC1D29-Antibody-Immunohistochemistry-NBP2-32437-img0002.jpg)
Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of oral mucosa.
![Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of skin cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6726_TBC1D29-Antibody-Immunohistochemistry-NBP2-32437-img0003.jpg)
Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of skin cancer
![Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6727_TBC1D29-Antibody-Immunohistochemistry-NBP2-32437-img0004.jpg)
Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.
![Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of skin cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6728_TBC1D29%2520Antibody-Immunohistochemistry-NBP2-32437-img0006.jpg)
Immunohistochemistry: TBC1D29 Antibody [NBP2-32437] - Staining of skin cancer