UGT3A2 Antibody
| Name | UGT3A2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32468 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UGT3A2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UGT3A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: UGT3A2 Antibody [NBP2-32468] - Staining of human cell line SH-SY5Y shows localization to nucleus, cytosol & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9033_UGT3A2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32468-img0007.jpg)
Immunocytochemistry/Immunofluorescence: UGT3A2 Antibody [NBP2-32468] - Staining of human cell line SH-SY5Y shows localization to nucleus, cytosol & the Golgi apparatus.
![Immunohistochemistry-Paraffin: UGT3A2 Antibody [NBP2-32468] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9034_UGT3A2-Antibody-Immunohistochemistry-Paraffin-NBP2-32468-img0008.jpg)
Immunohistochemistry-Paraffin: UGT3A2 Antibody [NBP2-32468] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.