CAPSL Antibody
| Name | CAPSL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32387 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CAPSL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CAPSL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CAPSL Antibody [NBP2-32387] - Staining of human cell line U-2 OS shows localization to nucleus & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10420_CAPSL-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32387-img0007.jpg)
Immunocytochemistry/Immunofluorescence: CAPSL Antibody [NBP2-32387] - Staining of human cell line U-2 OS shows localization to nucleus & microtubules.
![Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows distinct positivity in cytoplasm and cilia in subsets of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10421_CAPSL-Antibody-Immunohistochemistry-Paraffin-NBP2-32387-img0008.jpg)
Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows distinct positivity in cytoplasm and cilia in subsets of glandular cells.