C19orf73 Antibody
| Name | C19orf73 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32367 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C19orf73 Protein |
| Description | Rabbit Polyclonal |
| Gene | C19orf73 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: C19orf73 Antibody [NBP2-32367] - Staining of human cell line A549 shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11365_C19orf73-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32367-img0006.jpg)
![Immunohistochemistry-Paraffin: C19orf73 Antibody [NBP2-32367] - Staining of human rectum shows weak cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11366_C19orf73%2520Antibody-Immunohistochemistry-Paraffin-NBP2-32367-img0007.jpg)