FN3K Antibody
| Name | FN3K Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32349 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FN3K Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FN3K |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FN3K Antibody [NBP2-32349] - Staining of human fallopian tube shows distinct positivity in red blood cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2063_FN3K%2520Antibody-Immunohistochemistry-Paraffin-NBP2-32349-img0007.jpg)
Immunohistochemistry-Paraffin: FN3K Antibody [NBP2-32349] - Staining of human fallopian tube shows distinct positivity in red blood cells.