SP4 Antibody
| Name | SP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31983 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SP4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SP4 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SP4 Antibody [NBP2-31983] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7410_SP4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31983-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SP4 Antibody [NBP2-31983] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunohistochemical staining of human lymph node shows distinct nuclear positivity in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7411_SP4-Antibody-Immunohistochemistry-NBP2-31983-img0004.jpg)
Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunohistochemical staining of human lymph node shows distinct nuclear positivity in non-germinal center cells.
![Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7412_SP4-Antibody-Immunohistochemistry-NBP2-31983-img0001.jpg)
Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunohistochemical staining of human lymph node shows distinct nuclear positivity in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7413_SP4-Antibody-Immunohistochemistry-NBP2-31983-img0002.jpg)
Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunohistochemical staining of human lymph node shows distinct nuclear positivity in non-germinal center cells.
![Immunohistochemistry: SP4 Antibody [NBP2-31983] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7414_SP4%2520Antibody-Immunohistochemistry-NBP2-31983-img0005.jpg)
Immunohistochemistry: SP4 Antibody [NBP2-31983] - liver