PLOD1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31885
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PLOD1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PLOD1
• Conjugate: Unconjugated

Product images

Western Blot: PLOD1 Antibody [NBP2-31885] - Analysis in human cell line U-251 MG.

Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-31885] - Staining of human placenta shows cytoplasmic positivity in decidual cells.

Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of liver.

Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry: PLOD1 Antibody [NBP2-31885] - Staining of liver cancer..