thymocyte selection-associated high mobility group box Antibody
| Name | thymocyte selection-associated high mobility group box Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87857 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | thymocyte selection-associated high mobility group box Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TOX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Analysis in human cell line MOLT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6511_thymocyte%2520selection-associated%2520high%2520mobility%2520group%2520box%2520Antibody-Western%2520Blot-NBP1-87857-img0009.jpg)
Western Blot: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Analysis in human cell line MOLT-4.
![Immunohistochemistry-Paraffin: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Immunohistochemical staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6512_thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0008.jpg)
Immunohistochemistry-Paraffin: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Immunohistochemical staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.
![Immunohistochemistry-Paraffin: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells and a subset of non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6513_thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0006.jpg)
Immunohistochemistry-Paraffin: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells and a subset of non-germinal center cells.
![Immunohistochemistry-Paraffin: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6514_thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0007.jpg)
Immunohistochemistry-Paraffin: thymocyte selection-associated high mobility group box Antibody [NBP1-87857] - Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.