P15RS Antibody

Name P15RS Antibody
Supplier Novus Biologicals
Catalog NBP1-87917
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL
Purity/Format Immunogen affinity purified
Blocking Peptide P15RS Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RPRD1A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.